PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Trihelix
Protein Properties Length: 123aa    MW: 13481.8 Da    PI: 6.1333
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35873.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix34.84.2e-1189123135
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevs 35 
                 rW++qe+l L+e+r++++++++++++k+plW+evs
  KFK35873.1  89 RWPRQETLMLLEVRSRLDHKFKEANQKGPLWDEVS 123
                 8*********************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MEDHQNHPQY GIPLPQPSPH FSSDLFGFNI VSGPDQHHRV QFTDHEMGFL PRGVQGLTVA  60
GPNSNTVVAS TSGGGGGFSG FTDGGETGRW PRQETLMLLE VRSRLDHKFK EANQKGPLWD  120
EVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ6304871e-108AJ630487.1 Arabidopsis thaliana mRNA for hypothetical protein, clone At3g10000.
GenBankATAC0109271e-108AC010927.5 Arabidopsis thaliana chromosome III BAC T22K18 genomic sequence, complete sequence.
GenBankCP0026861e-108CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001189853.12e-66embryo sac development arrest protein 31
RefseqNP_187611.23e-66embryo sac development arrest protein 31
SwissprotQ9LZS04e-30PTL_ARATH; Trihelix transcription factor PTL
TrEMBLA0A087H1718e-87A0A087H171_ARAAL; Uncharacterized protein (Fragment)
STRINGAT3G10000.18e-66(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10000.22e-55Trihelix family protein